HIGDB - Haemophilus influenzae Genome Database

Protein search results for - Q4QKJ8

Names and origin
Entry : Q4QKJ8 (reviewed)
Entry name : RS15_HAEI8
Protein names : 30S ribosomal protein S15
Organism : Haemophilus influenzae 86-028NP
Organism ID : 281310
Gene names : rpsO
ORF names : NTHI1652
History
Date of creation : 2006-01-24
Date of modification : 2013-11-13
Date of sequence modification : 2005-07-19
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : rRNA binding; ribosome; structural constituent of ribosome; translation
GO identifier : GO:0019843; GO:0005840; GO:0003735; GO:0006412
Keywords
Ligand & Biological process : Complete proteome; RNA-binding; Ribonucleoprotein; Ribosomal protein; rRNA-binding
General annotation
Sequence similarities : Belongs to Ribosomal protein S15P family
Reference
PubMed ID : 15968074
Protein sequence
Length : 97 residues
>Q4QKJ8|RS15_HAEI8 Haemophilus influenzae 86-028NP
MSLSTEKKAAIVAEFGRDAKDTGSSEVQIALLTAQINHLQAHFAEHKKDHHGRRGLLRMV
SRRRKLLDYLKRTDLALYQSTIARLGLRR