HIGDB - Haemophilus influenzae Genome Database

Protein search results for - Q4QKG0

Names and origin
Entry : Q4QKG0 (reviewed)
Entry name : Y1697_HAEI8
Protein names : UPF0181 protein NTHI1697
Organism : Haemophilus influenzae 86-028NP
Organism ID : 281310
Gene names : NTHI1697
History
Date of creation : 2006-05-30
Date of modification : 2013-11-13
Date of sequence modification : 2005-07-19
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : Complete proteome
General annotation
Sequence similarities : Belongs to UPF0181 family
Reference
PubMed ID : 15968074
Protein sequence
Length : 56 residues
>Q4QKG0|Y1697_HAEI8 Haemophilus influenzae 86-028NP
MFDINLTHEQQQKAVEQIQELMAKGISSGEAIQIVAKALREIHKNDKKTPDN