HIGDB - Haemophilus influenzae Genome Database

Protein search results for - Q4QKF9

Names and origin
Entry : Q4QKF9 (unreviewed)
Entry name : Q4QKF9_HAEI8
Protein names : Cold shock-like protein CspD
Organism : Haemophilus influenzae 86-028NP
Organism ID : 281310
Gene names : cspD
ORF names : NTHI1698
History
Date of creation : 2005-07-19
Date of modification : 2013-11-13
Date of sequence modification : 2005-07-19
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA binding; cytoplasm; regulation of transcription, DNA-dependent; response to stress
GO identifier : GO:0003677; GO:0005737; GO:0006355; GO:0006950
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm
General annotation
Domains : CSD (cold-shock) domain (1)
Subcellular location : Cytoplasm.
Reference
PubMed ID : 15968074
Protein sequence
Length : 80 residues
>Q4QKF9|Q4QKF9_HAEI8 Haemophilus influenzae 86-028NP
MEIGIVKWFNNAKGFGFISAEGVDADIFAHYSVIEMDGYRSLKAGQKVQFEVLHSDKGSH
ATKIIPIADTQE