HIGDB - Haemophilus influenzae Genome Database

Protein search results for - Q4QK79

Names and origin
Entry : Q4QK79 (unreviewed)
Entry name : Q4QK79_HAEI8
Protein names : Probable molybdenum-pterin binding protein
Organism : Haemophilus influenzae 86-028NP
Organism ID : 281310
Gene names : mop
ORF names : NTHI1793
History
Date of creation : 2005-07-19
Date of modification : 2013-11-13
Date of sequence modification : 2005-07-19
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : ATP binding; ATP-binding cassette (ABC) transporter complex; hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances; molybdenum ion binding
GO identifier : GO:0005524; GO:0043190; GO:0016820; GO:0030151
Keywords
Ligand & Biological process : Complete proteome
Reference
PubMed ID : 15968074
Protein sequence
Length : 77 residues
>Q4QK79|Q4QK79_HAEI8 Haemophilus influenzae 86-028NP
MKISARNQLKGKVVSIENGSVNAIVHIDIGGGNVLSSTVSLAAVKELNLEVGKEAYAIIK
ATSVMVGVE