HIGDB - Haemophilus influenzae Genome Database

Protein search results for - Q4QJU8

Names and origin
Entry : Q4QJU8 (reviewed)
Entry name : IHFB_HAEI8
Protein names : Integration host factor subunit beta (IHF-beta)
Organism : Haemophilus influenzae 86-028NP
Organism ID : 281310
Gene names : ihfB
ORF names : himD
History
Date of creation : 2008-02-05
Date of modification : 2013-11-13
Date of sequence modification : 2005-07-19
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA binding; DNA recombination; chromosome; regulation of transcription, DNA-dependent; regulation of translation; transcription, DNA-dependent
GO identifier : GO:0003677; GO:0006310; GO:0005694; GO:0006355; GO:0006417; GO:0006351
Keywords
Ligand & Biological process : Complete proteome; DNA recombination; DNA-binding; Transcription; Transcription regulation; Translation regulation
General annotation
Sequence similarities : Belongs to Bacterial histone-like protein family
Reference
PubMed ID : 15968074
Protein sequence
Length : 102 residues
>Q4QJU8|IHFB_HAEI8 Haemophilus influenzae 86-028NP
MTKSELMEKLSAKQPTLSAKEIENMVKDILEFISQSLENGDRVEVRGFGSFSLHHRQPRL
GRNPKTGDSVNLSAKSVPYFKAGKELKARVDVQA