HIGDB - Haemophilus influenzae Genome Database

Protein search results for - Q4QJT7

Names and origin
Entry : Q4QJT7 (reviewed)
Entry name : Y1958_HAEI8
Protein names : UPF0102 protein NTHI1958
Organism : Haemophilus influenzae 86-028NP
Organism ID : 281310
Gene names : NTHI1958
History
Date of creation : 2006-02-07
Date of modification : 2013-11-13
Date of sequence modification : 2005-07-19
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : nuclease activity; nucleic acid binding; nucleic acid phosphodiester bond hydrolysis
GO identifier : GO:0004518; GO:0003676; GO:0090305
Keywords
Ligand & Biological process : Complete proteome
General annotation
Sequence similarities : Belongs to UPF0102 family
Reference
PubMed ID : 15968074
Protein sequence
Length : 127 residues
>Q4QJT7|Y1958_HAEI8 Haemophilus influenzae 86-028NP
MFSLKRQQGASFEHQARLFLESKGLTFIAANQNFKCGELDLIMNDKETIVFVEVRQRSHS
AYGSAIESVDWRKQQKWLDAANLWLAKQNMSLEDANCRFDLIAFGKTPQDIQWIPNFLD