HIGDB - Haemophilus influenzae Genome Database

Protein search results for - Q4QJN0

Names and origin
Entry : Q4QJN0 (unreviewed)
Entry name : Q4QJN0_HAEI8
Protein names : Phosphocarrier protein HPr
Organism : Haemophilus influenzae 86-028NP
Organism ID : 281310
Gene names : ptsH
ORF names : NTHI2022
History
Date of creation : 2005-07-19
Date of modification : 2013-11-13
Date of sequence modification : 2005-07-19
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; kinase activity; phosphoenolpyruvate-dependent sugar phosphotransferase system; sugar:hydrogen symporter activity
GO identifier : GO:0005737; GO:0016301; GO:0009401; GO:0005351
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Kinase; Phosphotransferase system; Transferase
General annotation
Subcellular location : Cytoplasm.
Reference
PubMed ID : 15968074
Protein sequence
Length : 93 residues
>Q4QJN0|Q4QJN0_HAEI8 Haemophilus influenzae 86-028NP
MYSKDVEIIAPNGLHTRPAAQFVKEAKAFSSEITVTSGGKSASAKSLFKLQTLVLTQGTI
LTISADGEDEQQAVEHLVALIPTLE