HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P71390

Names and origin
Entry : P71390 (reviewed)
Entry name : VCOM_HAEIN
Protein names : Mu-like prophage FluMu protein com
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
ORF names : HI_1522.1
History
Date of creation : 2000-05-30
Date of modification : 2013-11-13
Date of sequence modification : 1997-02-01
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : Complete proteome; Reference proteome
General annotation
Sequence similarities : Belongs to Com family
Reference
PubMed ID : 7542800;
Protein sequence
Length : 43 residues
>P71390|VCOM_HAEIN Haemophilus influenzae Rd KW20
MQSIKTIRCTFCNKLLAKVGTVGYLEIKCPRCKVINFTK