HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P71388

Names and origin
Entry : P71388 (reviewed)
Entry name : VPC_HAEIN
Protein names : Mu-like prophage FluMu protein C
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
ORF names : HI_1491
History
Date of creation : 1999-07-15
Date of modification : 2013-10-16
Date of sequence modification : 1997-02-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA binding; regulation of transcription, DNA-dependent; transcription, DNA-dependent
GO identifier : GO:0003677; GO:0006355; GO:0006351
Keywords
Ligand & Biological process : Complete proteome; DNA-binding; Reference proteome; Transcription; Transcription regulation
General annotation
Sequence similarities : Belongs to C/mor transcriptional regulatory family
Reference
PubMed ID : 7542800
Protein sequence
Length : 80 residues
>P71388|VPC_HAEIN Haemophilus influenzae Rd KW20
MAHYFGGKSFYLPAGDKIKEALRDAQIYQEFNGKNVPDLIKKYRLSESTIYAILRNQRTL
QRKRHQMDFNFS