HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P71375

Names and origin
Entry : P71375 (reviewed)
Entry name : Y1315_HAEIN
Protein names : Putative uncharacterized symporter HI_1315
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
ORF names : HI_1315
History
Date of creation : 1997-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1997-02-01
Protein attributes
Protein existence : Uncertain
Gene Ontology (GO)
GO term name : integral to membrane; plasma membrane; transmembrane transport; transporter activity
GO identifier : GO:0016021; GO:0005886; GO:0055085; GO:0005215
Keywords
Ligand & Biological process : Cell membrane; Complete proteome; Membrane; Reference proteome; Transmembrane; Transmembrane helix
General annotation
Sequence similarities : Belongs to Sodium:solute symporter (SSF) (TC 2.A.21) family
Subcellular location : Cell membrane; Multi-pass membrane protein.
Reference
PubMed ID : 7542800
Protein sequence
Length : 113 residues
>P71375|Y1315_HAEIN Haemophilus influenzae Rd KW20
MLVDMGEQYMLTTILSFLIVTTVVAYVSWLKTKGDDLKSSKGYFLAGRGLSGLVIGCSMV
LTSLSTEQLIGVNAVSYKGNFSVIAWTVPTVIPLCFLALYIIGWL