HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P71363

Names and origin
Entry : P71363 (reviewed)
Entry name : VAPC2_HAEIN
Protein names : Probable ribonuclease VapC2 (Probable RNase VapC2) (EC 3.1.-.-) (Toxin VapC2)
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : vapC2
ORF names : HI_0947
EC number : 3.1.-.-
History
Date of creation : 1997-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1997-02-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : magnesium ion binding; nucleic acid phosphodiester bond hydrolysis; ribonuclease activity
GO identifier : GO:0000287; GO:0090305; GO:0004540
Keywords
Ligand & Biological process : Complete proteome; Hydrolase; Magnesium; Metal-binding; Nuclease; Reference proteome; Toxin
General annotation
Domains : PINc domain (1)
Sequence similarities : Belongs to PINc/VapC protein family
Reference
PubMed ID : 7542800
Protein sequence
Length : 144 residues
>P71363|VAPC2_HAEIN Haemophilus influenzae Rd KW20
MLKYMLDTNIVIYVIKRRPLEILSRFNQNAGKMCVSSITVAELYYGAEKSEYPERNIAVI
EDFLSRLTILDYQPKHAAHFGNIKAELSKQGKLIGENDIHIAAHARSEGLILVSNNLREF
ERVIALRTENWV