HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P71358

Names and origin
Entry : P71358 (reviewed)
Entry name : CYAY_HAEIN
Protein names : Protein CyaY
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : cyaY
ORF names : HI_0727.1
History
Date of creation : 1999-07-15
Date of modification : 2013-11-13
Date of sequence modification : 1997-02-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ferric iron binding; iron-sulfur cluster assembly
GO identifier : GO:0008199; GO:0016226
Keywords
Ligand & Biological process : Complete proteome; Reference proteome
General annotation
Sequence similarities : Belongs to Frataxin family
Reference
PubMed ID : 7542800;
Protein sequence
Length : 109 residues
>P71358|CYAY_HAEIN Haemophilus influenzae Rd KW20
MNIAEFHQNIEQVWQKIEEELENQGADVDCETQGSVFTITFDNRTQIVINKQEPLLELWI
ASKLGGFHFAFKNGDWVSNDGQRFWDCFVEACAAHGENVQF