HIGDB: Haemophilus influenzae Genome Database

Protein search results for - P71351

Names and origin

Entry	:	P71351 (reviewed)
Entry name	:	VAPD_HAEIN
Protein names	:	Endoribonuclease VapD (EC 3.1.-.-) (Virulence-associated protein D)
Organism	:	Haemophilus influenzae Rd KW20
Organism ID	:	71421
Gene names	:	vapD
ORF names	:	HI_0450
EC number	:	3.1.-.-

History

Date of creation	:	1999-07-15
Date of modification	:	2013-11-13
Date of sequence modification	:	1997-02-01

Protein attributes

Protein existence

Evidence at protein level

Gene Ontology (GO)

GO term name	:	nuclease activity; nucleic acid phosphodiester bond hydrolysis; pathogenesis
GO identifier	:	GO:0004518; GO:0090305; GO:0009405

Keywords

Ligand & Biological process

Complete proteome; Direct protein sequencing; Hydrolase; Nuclease; Reference proteome; Virulence

General annotation

Sequence similarities

Belongs to VapD ribonuclease family

Reference

PubMed ID

7542800; 10675023

Protein sequence

Length

99 residues

>P71351|VAPD_HAEIN Haemophilus influenzae Rd KW20
MYAIAFLVVKDTQDYHPKGVQQAYTDIGAVLAKFGFVRTQGSLYINMNEDMANLFQAMNA
LKQLAWISQSVRDIRAFRIEQWSDFTDFIRN