HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P67901

Names and origin
Entry : P67901 (reviewed)
Entry name : RS10_HAEIN
Protein names : 30S ribosomal protein S10
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : rpsJ
ORF names : rps10
History
Date of creation : 2004-10-11
Date of modification : 2013-11-13
Date of sequence modification : 2004-10-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ribosome; structural constituent of ribosome; tRNA binding; translation
GO identifier : GO:0005840; GO:0003735; GO:0000049; GO:0006412
Keywords
Ligand & Biological process : Complete proteome; Reference proteome; Ribonucleoprotein; Ribosomal protein
General annotation
Sequence similarities : Belongs to Ribosomal protein S10P family
Reference
PubMed ID : 7542800
Protein sequence
Length : 111 residues
>P67901|RS10_HAEIN Haemophilus influenzae Rd KW20
MQNQRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKD
ARDQYEIRTHKRLVDIVEPTEKTVDALMRLDLAAGVDVQISLG