HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P66244

Names and origin
Entry : P66244 (reviewed)
Entry name : RL34_HAEIN
Protein names : 50S ribosomal protein L34
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : rpmH
ORF names : rpl34
History
Date of creation : 2004-10-11
Date of modification : 2013-11-13
Date of sequence modification : 2004-10-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ribosome; structural constituent of ribosome; translation
GO identifier : GO:0005840; GO:0003735; GO:0006412
Keywords
Ligand & Biological process : Complete proteome; Reference proteome; Ribonucleoprotein; Ribosomal protein
General annotation
Sequence similarities : Belongs to Ribosomal protein L34P family
Reference
PubMed ID : 7542800
Protein sequence
Length : 48 residues
>P66244|RL34_HAEIN Haemophilus influenzae Rd KW20
MKRTFQPSVLKRSRTHGFRARMATKNGRQVLARRRAKGRKSLSA