HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P57047

Names and origin
Entry : P57047 (reviewed)
Entry name : TATB_HAEIN
Protein names : Sec-independent protein translocase protein TatB
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : tatB
ORF names : HI_0187.1
History
Date of creation : 2000-12-01
Date of modification : 2013-11-13
Date of sequence modification : 2000-12-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : TAT protein transport complex; integral to plasma membrane; protein secretion; protein transmembrane transporter activity; protein transport by the Tat complex
GO identifier : GO:0033281; GO:0005887; GO:0009306; GO:0008320; GO:0043953
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Complete proteome; Membrane; Protein transport; Reference proteome; Translocation; Transmembrane; Transmembrane helix; Transport
General annotation
Sequence similarities : Belongs to TatB family
Subcellular location : Cell inner membrane; Single-pass membrane protein.
Reference
PubMed ID : 7542800
Protein sequence
Length : 202 residues
>P57047|TATB_HAEIN Haemophilus influenzae Rd KW20
MFDIGFSELILLMVLGLVVLGPKRLPIAIRTVMDWVKTIRGLAANVQNELKQELKLQELQ
DSIKKAESLNLQALSPELSKTVEELKAQADKMKAELEDKAAQAGTTVEDQIKEIKSAAEN
AEKSQNAISVEEAAETLSEAERTPTDLTALETHEKVELNTHLSSYYPPDDIEIAPASKSQ
SSKTKS