HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P56507

Names and origin
Entry : P56507 (reviewed)
Entry name : Y143A_HAEIN
Protein names : UPF0181 protein HI_1434.2
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
ORF names : HI_1434.2
History
Date of creation : 1998-07-15
Date of modification : 2013-11-13
Date of sequence modification : 1998-07-15
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : Complete proteome; Reference proteome
General annotation
Sequence similarities : Belongs to UPF0181 family
Reference
PubMed ID : 7542800; 9588799
Protein sequence
Length : 56 residues
>P56507|Y143A_HAEIN Haemophilus influenzae Rd KW20
MFDINLTHEQQQKAVEQIQELMAQGISSGEAIQIVAKALREIHKNDKKTPEN