HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P46496

Names and origin
Entry : P46496 (reviewed)
Entry name : NER_HAEIN
Protein names : Mu-like prophage FluMu DNA-binding protein Ner
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : nlp
ORF names : HI_1477
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA binding; regulation of transcription, DNA-dependent; transcription, DNA-dependent
GO identifier : GO:0003677; GO:0006355; GO:0006351
Keywords
Ligand & Biological process : Complete proteome; DNA-binding; Reference proteome; Repressor; Transcription; Transcription regulation
General annotation
Sequence similarities : Belongs to Ner transcriptional regulatory family
Reference
PubMed ID : 7542800
Protein sequence
Length : 97 residues
>P46496|NER_HAEIN Haemophilus influenzae Rd KW20
MSVLEKPKKTAEQDWHRADILAELKKNGWSLRSLAKEGQVSYNTLKTVLDKSYPKMERLV
ANAIGVPPEVIWAGRFAERNKRPTLQHKY