HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P46492

Names and origin
Entry : P46492 (reviewed)
Entry name : METI_HAEIN
Protein names : Probable D-methionine transport system permease protein MetI
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : metI
ORF names : HI_0620.1
History
Date of creation : 1995-11-01
Date of modification : 2013-10-16
Date of sequence modification : 2002-09-19
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : integral to membrane; plasma membrane; transporter activity
GO identifier : GO:0016021; GO:0005886; GO:0005215
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Complete proteome; Membrane; Reference proteome; Transmembrane; Transmembrane helix; Transport
General annotation
Domains : ABC transmembrane type-1 domain (1)
Sequence similarities : Belongs to Binding-protein-dependent transport system permease family, CysTW subfamily
Subcellular location : Cell inner membrane; Multi-pass membrane protein.
Reference
PubMed ID : 7542800;
Protein sequence
Length : 229 residues
>P46492|METI_HAEIN Haemophilus influenzae Rd KW20
MWGVVATATYETVYISFASTLLAVLVGVPVGIWTFLTGKNEILQNNRTHFVLNTIINIGR
SIPFIILLLILLPVTRFIVGTVLGTTAAIIPLSICAMPFVARLTANALMEIPNGLTEAAQ
AMGATKWQIVRKFYLSEALPTLINGVTLTLVTLVGYSAMAGTQGGGGLGSLAINYGRIRN
MPYVTWVATIIIVLFVMISQKLGDTLAKKVDHR