HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P46491

Names and origin
Entry : P46491 (reviewed)
Entry name : CRCB_HAEIN
Protein names : Putative fluoride ion transporter CrcB
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : crcB
ORF names : HI_0597.1
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : inorganic anion transmembrane transporter activity; inorganic anion transport; integral to plasma membrane
GO identifier : GO:0015103; GO:0015698; GO:0005887
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Complete proteome; Membrane; Reference proteome; Transmembrane; Transmembrane helix; Transport
General annotation
Sequence similarities : Belongs to CrcB (TC 9.B.71) family
Subcellular location : Cell inner membrane; Multi-pass membrane protein.
Reference
PubMed ID : 7542800;
Protein sequence
Length : 172 residues
>P46491|CRCB_HAEIN Haemophilus influenzae Rd KW20
MQALLFISYGAILGASLRWAIGLLFNPLFSSFAFGTLIANLFGCLIIGVLLGLFWQFPQI
SAEWRLFLITGFLGSLTTFSSFSSEVVELFFNDKWLNGFCVLMMHLFGCLAMTVLGIWIY
KICLNFYLNPIHFGFAQLNQQIHRYEIRVIAYIAKFFVSF