HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P46449

Names and origin
Entry : P46449 (reviewed)
Entry name : CSPD_HAEIN
Protein names : Cold shock-like protein CspD
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : cspD
ORF names : HI_1434.1
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA binding; cytoplasm; regulation of transcription, DNA-dependent; response to stress
GO identifier : GO:0003677; GO:0005737; GO:0006355; GO:0006950
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; DNA-binding; Reference proteome
General annotation
Domains : CSD (cold-shock) domain (1)
Subcellular location : Cytoplasm.
Reference
PubMed ID : 7542800;
Protein sequence
Length : 80 residues
>P46449|CSPD_HAEIN Haemophilus influenzae Rd KW20
MEIGIVKWFNNAKGFGFISAEGVDADIFAHYSVIEMDGYRSLKAGQKVQFEVLHSDKGSH
ATKIIPIADTQE