HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P45338

Names and origin
Entry : P45338 (reviewed)
Entry name : PTGA_HAEIN
Protein names : Glucose-specific phosphotransferase enzyme IIA component (EC 2.7.1.-) (EIIA-Glc) (EIII-Glc) (PTS system glucose-specific EIIA component)
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : crr
ORF names : HI_1711
EC number : 2.7.1.-
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 2007-01-23
Protein attributes
Protein existence : Evidence at protein level
Gene Ontology (GO)
GO term name : cytoplasm; kinase activity; membrane; phosphoenolpyruvate-dependent sugar phosphotransferase system; sugar:hydrogen symporter activity
GO identifier : GO:0005737; GO:0016301; GO:0016020; GO:0009401; GO:0005351
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Direct protein sequencing; Kinase; Phosphotransferase system; Reference proteome; Sugar transport; Transferase; Transport
General annotation
Domains : PTS EIIA type-1 domain (1)
Subcellular location : Cytoplasm.
Reference
PubMed ID : 7542800; 10675023
Protein sequence
Length : 178 residues
>P45338|PTGA_HAEIN Haemophilus influenzae Rd KW20
MGLFDKLFGSKENKSVEVEIYARISGEIVNIEDVPDVVFSEKIVGDGVAVRPIGNKIVAP
VDGVIGKIFETNHAFSMESKEGVELFVHFGIDTVELKGEGFTRIAQEGQSVKRGDTVIEF
DLALLESKAKSVLTPIVISNMDEISCIVKKSGEVVAGESVVLALKK