HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P45322

Names and origin
Entry : P45322 (reviewed)
Entry name : MODB_HAEIN
Protein names : Molybdenum transport system permease protein ModB
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : modB
ORF names : HI_1692
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : integral to membrane; molybdate ion transmembrane transporter activity; plasma membrane
GO identifier : GO:0016021; GO:0015098; GO:0005886
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Complete proteome; Membrane; Molybdenum; Reference proteome; Transmembrane; Transmembrane helix; Transport
General annotation
Domains : ABC transmembrane type-1 domain (1)
Sequence similarities : Belongs to Binding-protein-dependent transport system permease family, CysTW subfamily
Subcellular location : Cell inner membrane; Multi-pass membrane protein.
Reference
PubMed ID : 7542800
Protein sequence
Length : 245 residues
>P45322|MODB_HAEIN Haemophilus influenzae Rd KW20
MEISAINLSLSVAVSSMLWSLPLAIFVAWLLARKNFYGKSLITGVIHLPLVLPPVVIGYL
LLVAMGRNGFIGKYLYQWFGLSFGFSWKGAVLSSAVVAFPLVVRAIRLSLENIDIKLEQA
AQTLGASAWRVFFTITLPLSLPGVLAGLVLGFARSLGEFGATITFVSNIAGETQTIPLAM
YSFIQTPGAEEQTARLCLFAIILSLISLLLSEWLSKRMQKKLGQGNVAD