HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P45309

Names and origin
Entry : P45309 (reviewed)
Entry name : MOAD_HAEIN
Protein names : Molybdopterin synthase sulfur carrier subunit (MPT synthase subunit 1) (Molybdenum cofactor biosynthesis protein D) (Molybdopterin-converting factor small subunit) (Molybdopterin-converting factor subunit 1) (Sulfur carrier protein MoaD)
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : moaD
ORF names : HI_1674
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1997-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : Mo-molybdopterin cofactor biosynthetic process; nucleotide binding
GO identifier : GO:0006777; GO:0000166
Keywords
Ligand & Biological process : Complete proteome; Molybdenum cofactor biosynthesis; Nucleotide-binding; Reference proteome
General annotation
Pathway : Cofactor biosynthesis; molybdopterin biosynthesis.
Sequence similarities : Belongs to MoaD family
Reference
PubMed ID : 7542800;
Protein sequence
Length : 89 residues
>P45309|MOAD_HAEIN Haemophilus influenzae Rd KW20
MLNVLFFAQTRELIGVDAIQLEDDFATAEAVREHLAQKGDKWALALEKGKLLVAINQTLM
PLESAVKNGDEIAFFPPVTGG