HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P45300

Names and origin
Entry : P45300 (reviewed)
Entry name : Y1656_HAEIN
Protein names : UPF0102 protein HI_1656
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
ORF names : HI_1656
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : nuclease activity; nucleic acid binding; nucleic acid phosphodiester bond hydrolysis
GO identifier : GO:0004518; GO:0003676; GO:0090305
Keywords
Ligand & Biological process : Complete proteome; Reference proteome
General annotation
Sequence similarities : Belongs to UPF0102 family
Reference
PubMed ID : 7542800
Protein sequence
Length : 127 residues
>P45300|Y1656_HAEIN Haemophilus influenzae Rd KW20
MFSLKRQQGASFEHQARLFLESKGLIFIAANQNFKCGELDLIMNDKETIVFVEVRQRSHS
AYGSAIESVDWRKQQKWLDAANLWLAKQNMSLEDANCRFDLIAFGKTPQDIQWIPNFLD