HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P45247

Names and origin
Entry : P45247 (reviewed)
Entry name : LOLD_HAEIN
Protein names : Lipoprotein-releasing system ATP-binding protein LolD (EC 3.6.3.-)
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : lolD
ORF names : HI_1549
EC number : 3.6.3.-
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ATP binding; ATP catabolic process; ATPase activity; lipoprotein transporter activity; plasma membrane
GO identifier : GO:0005524; GO:0006200; GO:0016887; GO:0042954; GO:0005886
Keywords
Ligand & Biological process : ATP-binding; Cell inner membrane; Cell membrane; Complete proteome; Hydrolase; Membrane; Nucleotide-binding; Reference proteome; Transport
General annotation
Domains : ABC transporter domain (1)
Sequence similarities : Belongs to ABC transporter superfamily, Lipoprotein translocase (TC 3.A.1.125) family
Subcellular location : Cell inner membrane; Peripheral membrane protein.
Reference
PubMed ID : 7542800
Protein sequence
Length : 243 residues
>P45247|LOLD_HAEIN Haemophilus influenzae Rd KW20
MNNYLLKCENINKFYQEGENQTQVLKGVSFSMEPAELVAIVGSSGSGKSTLLHTLGGLDQ
PSSGEVFINGQSLQKASANELAALRNRYLGFVYQFHHLMADFTALENVMMPMLIGHQNKT
EAKDRAEKMLSAVGLSHRITHRPSALSGGERQRVAIARALVNNPSLVLADEPTGNLDHKT
TESIFELIQQLNQEQNIAFLLVTHDMGLAEKLSRRLVMQDGLLKEGA