HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P45242

Names and origin
Entry : P45242 (reviewed)
Entry name : GLRX_HAEIN
Protein names : Glutaredoxin
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : grxA
ORF names : grx
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cell redox homeostasis; cytoplasm; electron carrier activity; protein disulfide oxidoreductase activity
GO identifier : GO:0045454; GO:0005737; GO:0009055; GO:0015035
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Disulfide bond; Electron transport; Redox-active center; Reference proteome; Transport
General annotation
Domains : Glutaredoxin domain (1)
Sequence similarities : Belongs to Glutaredoxin family
Subcellular location : Cytoplasm.
Reference
PubMed ID : 7542800
Protein sequence
Length : 95 residues
>P45242|GLRX_HAEIN Haemophilus influenzae Rd KW20
MFVVIFGRPGCPYCVRAKNLAEKLKGEVADFDYRYVDIHAEGITKEDLSKSVGKPVETVP
QIFIDEKPIGGCTDFEALMKEQFGIVA