HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P45239

Names and origin
Entry : P45239 (reviewed)
Entry name : HTRB_HAEIN
Protein names : Lipid A biosynthesis lauroyl acyltransferase (EC 2.3.1.-) (Heat shock protein B)
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : htrB
ORF names : waaM
EC number : 2.3.1.-
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1998-12-15
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : Gram-negative-bacterium-type cell wall; Kdo2-lipid A biosynthetic process; integral to membrane; lipopolysaccharide core region biosynthetic process; plasma membrane; response to stress; transferase activity, transferring acyl groups other than amino-acyl
GO identifier : GO:0009276; GO:0036104; GO:0016021; GO:0009244; GO:0005886; GO:0006950; GO:0016747
Keywords
Ligand & Biological process : Acyltransferase; Cell inner membrane; Cell membrane; Complete proteome; Lipopolysaccharide biosynthesis; Membrane; Reference proteome; Stress response; Transferase; Transmembrane; Transmembrane helix
General annotation
Pathway : Glycolipid biosynthesis; KDO(2)-lipid A biosynthesis; KDO(2)-lipid A from CMP-3-deoxy-D-manno-octulosonate and lipid IV(A): step 3/4. Bacterial outer membrane biogenesis; lipopolysaccharide biosynthesis.
Sequence similarities : Belongs to HtrB/MsbB family
Subcellular location : Cell inner membrane; Single-pass membrane protein.
Reference
PubMed ID : 7542800; 7592970
Protein sequence
Length : 335 residues
>P45239|HTRB_HAEIN Haemophilus influenzae Rd KW20
MKNEKLPQFQPHFLAPKYWLFWLGVAIWRSILCLPYPILRHIGHGFGWLFSHLKVGERRA
AIARRNLELCFPDMPENEREVILQENLRSVGMAIIETGMAWFWSDSRIKKWSKVEGLHYL
KENQKDGIVLVGVHFLTLELGARIIGLHHPGIGVYRPNDNPLLDWLQTQGRLRSNKDMLD
RKDLRGMIKALRHEETIWYAPDHDYGRKNAVFVPFFAVPDTCTTTGSYYLLKSSQNSKVI
PFAPLRNKDGSGYTVSISAPVDFTDLQDETAIAARMNQIVEKEIMKDITIYMWLHRRFKT
RPDEKTPSLYD