HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P45189

Names and origin
Entry : P45189 (reviewed)
Entry name : PHOB_HAEIN
Protein names : Phosphate regulon transcriptional regulatory protein PhoB
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : phoB
ORF names : HI_1379
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA binding; cytoplasm; intracellular signal transduction; phosphate ion transport; phosphorelay response regulator activity; regulation of transcription, DNA-dependent; transcription, DNA-dependent
GO identifier : GO:0003677; GO:0005737; GO:0035556; GO:0006817; GO:0000156; GO:0006355; GO:0006351
Keywords
Ligand & Biological process : Activator; Complete proteome; Cytoplasm; DNA-binding; Phosphate transport; Phosphoprotein; Reference proteome; Transcription; Transcription regulation; Transport; Two-component regulatory system
General annotation
Domains : Response regulatory domain (1)
Subcellular location : Cytoplasm.
Reference
PubMed ID : 7542800
Protein sequence
Length : 247 residues
>P45189|PHOB_HAEIN Haemophilus influenzae Rd KW20
MTRKILIVEDECAIREMIALFLSQKYYDVIEASDFKTAINKIKENPKLILLDWMLPGRSG
IQFIQYIKKQESYAAIPIIMLTAKSTEEDCIACLNAGADDYITKPFSPQILLARIEAVWR
RIYEQQSQFIQIDELSIDENAQRVFFQQQEINLSSTEFKLLHFFMRHPEKVYSREQLLNR
IWHNDLEVEYRTVDSYIRRLRRNLAPFQCEHYIQTVRGSGYRFSSYLRDKQ