HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P45183

Names and origin
Entry : P45183 (reviewed)
Entry name : MOP_HAEIN
Protein names : Probable molybdenum-pterin-binding protein
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
ORF names : HI_1370
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ATP binding; ATP-binding cassette (ABC) transporter complex; hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances; molybdenum ion binding
GO identifier : GO:0005524; GO:0043190; GO:0016820; GO:0030151
Keywords
Ligand & Biological process : Complete proteome; Molybdenum; Reference proteome
Reference
PubMed ID : 7542800
Protein sequence
Length : 77 residues
>P45183|MOP_HAEIN Haemophilus influenzae Rd KW20
MKISARNQLKGKVVSIENGSVNAIVHIDIGGGNVLSSTVSLAAVKELNLEVGKEAYAIIK
ATSVMVGVE