HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P45154

Names and origin
Entry : P45154 (reviewed)
Entry name : Y1309_HAEIN
Protein names : Uncharacterized ferredoxin-like protein HI_1309
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
ORF names : HI_1309
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : 2 iron, 2 sulfur cluster binding; electron carrier activity; metal ion binding; oxidation-reduction process
GO identifier : GO:0051537; GO:0009055; GO:0046872; GO:0055114
Keywords
Ligand & Biological process : 2Fe-2S; Complete proteome; Electron transport; Iron; Iron-sulfur; Metal-binding; Reference proteome; Transport
General annotation
Domains : 2Fe-2S ferredoxin-type domain (1)
Reference
PubMed ID : 7542800
Protein sequence
Length : 90 residues
>P45154|Y1309_HAEIN Haemophilus influenzae Rd KW20
MKIHLIRHNTTLEFNNETSLLDHLEKNNIHHEYQCRSGYCGSCRVKIKKGKVSYKEMPLA
FIQPDEILLCCCHVESDIEIDL