HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P45116

Names and origin
Entry : P45116 (reviewed)
Entry name : Y1225_HAEIN
Protein names : Uncharacterized protein HI_1225
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
ORF names : HI_1225
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : regulation of translation; translation initiation factor activity
GO identifier : GO:0006417; GO:0003743
Keywords
Ligand & Biological process : Complete proteome; Protein biosynthesis; Reference proteome; Translation regulation
General annotation
Sequence similarities : Belongs to SUI1 family
Reference
PubMed ID : 7542800
Protein sequence
Length : 114 residues
>P45116|Y1225_HAEIN Haemophilus influenzae Rd KW20
MSDSVLVYSTDVGRIKEEKASVVRPKGDGVVRIQKQTSGRKGAGVSVITGLDLSDEELKK
LAAELKKRCGCGGAVKNGIIEIQGEKRDLLKQLLEQKGFKVKLSGG