HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P45089

Names and origin
Entry : P45089 (reviewed)
Entry name : ARTM_HAEIN
Protein names : Arginine ABC transporter permease protein ArtM
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : artM
ORF names : HI_1177
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : amino acid transport; integral to membrane; plasma membrane; transporter activity
GO identifier : GO:0006865; GO:0016021; GO:0005886; GO:0005215
Keywords
Ligand & Biological process : Amino-acid transport; Cell inner membrane; Cell membrane; Complete proteome; Membrane; Reference proteome; Transmembrane; Transmembrane helix; Transport
General annotation
Domains : ABC transmembrane type-1 domain (1)
Sequence similarities : Belongs to Binding-protein-dependent transport system permease family, HisMQ subfamily
Subcellular location : Cell inner membrane; Multi-pass membrane protein.
Reference
PubMed ID : 7542800; 8550458
Protein sequence
Length : 243 residues
>P45089|ARTM_HAEIN Haemophilus influenzae Rd KW20
MFQEYLSVIVKGIPTSLLLTVVSLLIAFFLALFLTFLLSMENKWIKSAVNLYLTLFTGTP
LLVQFFLIYAGPGQFQWIIDSPLWYVLSNAWFCAALALALNSAAYSTQLFHGAVKAIPKG
QWESCGALGLNRIQTLKILIPYALKRALPSYSNEIILVFKGTALASTITIMDIMGYARQL
YGTEYDALTIYGIAGGIYLIITGIATLLLRKLEKKVLAFERFEVSKA