HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P45080

Names and origin
Entry : P45080 (reviewed)
Entry name : NRDG_HAEIN
Protein names : Anaerobic ribonucleoside-triphosphate reductase-activating protein (EC 1.97.1.-) (Class III anaerobic ribonucleotide reductase small component)
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : nrdG
ORF names : HI_1155
EC number : 1.97.1.-
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : 4 iron, 4 sulfur cluster binding; [formate-C-acetyltransferase]-activating enzyme activity; cytoplasm; metal ion binding
GO identifier : GO:0051539; GO:0043365; GO:0005737; GO:0046872
Keywords
Ligand & Biological process : 4Fe-4S; Complete proteome; Cytoplasm; Iron; Iron-sulfur; Metal-binding; Oxidoreductase; Reference proteome; S-adenosyl-L-methionine
General annotation
Sequence similarities : Belongs to Organic radical-activating enzymes family
Subcellular location : Cytoplasm.
Reference
PubMed ID : 7542800
Protein sequence
Length : 167 residues
>P45080|NRDG_HAEIN Haemophilus influenzae Rd KW20
MNYLQYYPTDVINGEGTRCTLFVSGCTHACKGCYNQKSWSFSAGVLFDDVMEQQIINDLK
DTRIKRQGLTLSGGDPLHPLNVETLLPFVQRVKRECPDKDIWVWTGYKLDELDKQQRAML
PYIDVLIDGKFIQEQADPSLVWRGSANQIIHRFKL