HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P45038

Names and origin
Entry : P45038 (reviewed)
Entry name : DSBE_HAEIN
Protein names : Thiol:disulfide interchange protein DsbE (Cytochrome c biogenesis protein CcmG)
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : dsbE
ORF names : ccmG
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cell redox homeostasis; cytochrome complex assembly; disulfide oxidoreductase activity; integral to membrane; outer membrane-bounded periplasmic space; oxidation-reduction process; plasma membrane
GO identifier : GO:0045454; GO:0017004; GO:0015036; GO:0016021; GO:0030288; GO:0055114; GO:0005886
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Complete proteome; Cytochrome c-type biogenesis; Disulfide bond; Membrane; Redox-active center; Reference proteome; Transmembrane; Transmembrane helix
General annotation
Domains : Thioredoxin domain (1)
Sequence similarities : Belongs to Thioredoxin family, DsbE subfamily
Subcellular location : Cell inner membrane; Single-pass membrane protein; Periplasmic side.
Reference
PubMed ID : 7542800
Protein sequence
Length : 197 residues
>P45038|DSBE_HAEIN Haemophilus influenzae Rd KW20
MKKKLLVPLILFLSITIAFLVQLKRNAQGEDIKALESALVGKPVPAKNLTELFENKTYTN
ELFQQGEPVLLNVWATWCPTCYAEHQYLNKLAKEGVRIIGLDYKDESPKAMKWLKDLGNP
YQVVLKDEKGSFGLDLGVYGAPETFIVDGKGVIHYRYAGDVNEKVWTQTLKPIYDKLSEQ
Q