HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P45036

Names and origin
Entry : P45036 (reviewed)
Entry name : CCME_HAEIN
Protein names : Cytochrome c-type biogenesis protein CcmE (Cytochrome c maturation protein E) (Heme chaperone CcmE)
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : ccmE
ORF names : cycJ
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytochrome complex assembly; integral to membrane; metal ion binding; plasma membrane; protein-heme linkage
GO identifier : GO:0017004; GO:0016021; GO:0046872; GO:0005886; GO:0017003
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Complete proteome; Cytochrome c-type biogenesis; Heme; Iron; Membrane; Metal-binding; Reference proteome; Signal-anchor; Transmembrane; Transmembrane helix
General annotation
Sequence similarities : Belongs to CcmE/CycJ family
Subcellular location : Cell inner membrane; Single-pass type II membrane protein; Periplasmic side.
Reference
PubMed ID : 7542800
Protein sequence
Length : 185 residues
>P45036|CCME_HAEIN Haemophilus influenzae Rd KW20
MNPRRKSRFKLVIFVVLGIAIASGLMLYALRQNIDLFYTPSEVIQGKDNNPNQKPEVGQR
IRVGGMVVEGTVVRDPKSLKVRFDLNDIGPAITVEYEGILPDLFREGQGIVAQGVLTQPT
VLTATEVLAKHDENYVPPELGEKMQKVHKPMGIEAADLKGESARDRQEKEGAK