HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P45035

Names and origin
Entry : P45035 (reviewed)
Entry name : CCMD_HAEIN
Protein names : Heme exporter protein D (Cytochrome c-type biogenesis protein CcmD)
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : ccmD
ORF names : HI_1092
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytochrome complex assembly; heme transport; integral to membrane; plasma membrane
GO identifier : GO:0017004; GO:0015886; GO:0016021; GO:0005886
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Complete proteome; Cytochrome c-type biogenesis; Membrane; Reference proteome; Transmembrane; Transmembrane helix; Transport
General annotation
Sequence similarities : Belongs to CcmD/CycX/HelD family
Subcellular location : Cell inner membrane; Single-pass membrane protein.
Reference
PubMed ID : 7542800
Protein sequence
Length : 75 residues
>P45035|CCMD_HAEIN Haemophilus influenzae Rd KW20
MFFQTWSDFFNMGGYGFYVWLSYAVSLVAVIALIVQSVKQRKTVLQNVLREKQREERLQQ
ANKGNTL