HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P45029

Names and origin
Entry : P45029 (reviewed)
Entry name : Y1085_HAEIN
Protein names : Putative ABC transporter-binding protein HI_1085
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
ORF names : HI_1085
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : integral to membrane; plasma membrane; transport
GO identifier : GO:0016021; GO:0005886; GO:0006810
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Complete proteome; Membrane; Reference proteome; Signal-anchor; Transmembrane; Transmembrane helix; Transport
General annotation
Sequence similarities : Belongs to MlaD family
Subcellular location : Cell inner membrane; Single-pass type II membrane protein; Periplasmic side.
Reference
PubMed ID : 7542800
Protein sequence
Length : 179 residues
>P45029|Y1085_HAEIN Haemophilus influenzae Rd KW20
MRQTIKYEFWVGLFLLLGIGALVFLGLRVANVQGFAETKSYTVTATFDNIGGLKVRAPLK
IGGVVIGRVSAITLDEKSYLPKVSIAINQEYNEIPENSSLSIKTSGLLGEQYIALTMGFD
DGDTAMLKNGSQIQDTTSAMVLEDLIGQFLYGSKKSDGNEKSESTEQ