HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P44972

Names and origin
Entry : P44972 (reviewed)
Entry name : YIDD_HAEIN
Protein names : Putative membrane protein insertion efficiency factor
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
ORF names : HI_1000
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : plasma membrane
GO identifier : GO:0005886
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Complete proteome; Membrane; Reference proteome
General annotation
Sequence similarities : Belongs to UPF0161 family
Subcellular location : Cell inner membrane; Peripheral membrane protein; Cytoplasmic side.
Reference
PubMed ID : 7542800
Protein sequence
Length : 94 residues
>P44972|YIDD_HAEIN Haemophilus influenzae Rd KW20
MAETHSLGTKILIKIIRLYQIMISPFIGARCRFVPTCSCYGIEALKTHGLLKGGWLTLKR
VLKCHPLNAGGFDPVPPKTNNNDEKK