HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P44966

Names and origin
Entry : P44966 (reviewed)
Entry name : FIS_HAEIN
Protein names : DNA-binding protein fis
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : fis
ORF names : HI_0980
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription, DNA-dependent
GO identifier : GO:0043565; GO:0003700; GO:0006351
Keywords
Ligand & Biological process : Activator; Complete proteome; DNA-binding; Reference proteome; Transcription; Transcription regulation
General annotation
Sequence similarities : Belongs to Transcriptional regulatory fis family
Reference
PubMed ID : 7542800
Protein sequence
Length : 107 residues
>P44966|FIS_HAEIN Haemophilus influenzae Rd KW20
MLEQQRNSADALTVSVLNAQSQVTSKPLRDSVKQALRNYLAQLDGQDVNDLYELVLAEVE
HPMLDMIMQYTRGNQTRAANMLGINRGTLRKKLKKYGMG