HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P44959

Names and origin
Entry : P44959 (reviewed)
Entry name : RS20_HAEIN
Protein names : 30S ribosomal protein S20
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : rpsT
ORF names : HI_0965
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 2007-01-23
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : rRNA binding; ribosome; structural constituent of ribosome; translation
GO identifier : GO:0019843; GO:0005840; GO:0003735; GO:0006412
Keywords
Ligand & Biological process : Complete proteome; RNA-binding; Reference proteome; Ribonucleoprotein; Ribosomal protein; rRNA-binding
General annotation
Sequence similarities : Belongs to Ribosomal protein S20P family
Reference
PubMed ID : 7542800
Protein sequence
Length : 95 residues
>P44959|RS20_HAEIN Haemophilus influenzae Rd KW20
MANIKSAKKRAVQSEKRRQHNASQRSMMRTYIKKVYAQVAAGEKSAAEAAFVEMQKVVDR
MASKGLIHANKAANHKSKLAAQIKKLA