HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P44956

Names and origin
Entry : P44956 (reviewed)
Entry name : Y961_HAEIN
Protein names : HIT-like protein HI_0961 (EC 3.-.-.-) (Purine nucleoside phosphoramidase)
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
ORF names : HI_0961
EC number : 3.-.-.-
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Evidence at protein level
Gene Ontology (GO)
GO term name : hydrolase activity; metabolic process; nucleotide binding
GO identifier : GO:0016787; GO:0008152; GO:0000166
Keywords
Ligand & Biological process : Complete proteome; Hydrolase; Nucleotide-binding; Reference proteome
General annotation
Domains : HIT domain (1)
Sequence similarities : Belongs to HINT family
Reference
PubMed ID : 7542800; 10675023
Protein sequence
Length : 124 residues
>P44956|Y961_HAEIN Haemophilus influenzae Rd KW20
MAEETIFSKIIRKEIPANIVYQDELVTAFRDISPQAKTHILIIPNKVIPTVNDVTEQDEV
ALGRLFSVAAKLAKEEGVAEDGYRLIVNCNKHGGQEVFHLHMHLVGGEPLGRMLAK