HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P44946

Names and origin
Entry : P44946 (reviewed)
Entry name : NRDR_HAEIN
Protein names : Transcriptional repressor NrdR
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : nrdR
ORF names : HI_0943
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ATP binding; DNA binding; negative regulation of transcription, DNA-dependent; transcription, DNA-dependent; zinc ion binding
GO identifier : GO:0005524; GO:0003677; GO:0045892; GO:0006351; GO:0008270
Keywords
Ligand & Biological process : ATP-binding; Complete proteome; DNA-binding; Metal-binding; Nucleotide-binding; Reference proteome; Repressor; Transcription; Transcription regulation; Zinc; Zinc-finger
General annotation
Domains : ATP-cone domain (1)
Sequence similarities : Belongs to NrdR family
Reference
PubMed ID : 7542800
Protein sequence
Length : 161 residues
>P44946|NRDR_HAEIN Haemophilus influenzae Rd KW20
MHCPFCDTEETKVIDSRLVSDGYQVRRRRECGHCHERFTTFEMAELIIPKIIKTDGTREP
FNEDKLRSGIQHALEKRPVSADDVEKAINHIILQLRATGEREVPSKLVGKLAMNELKKLD
KVAYIRFASVYLSFDDIDQFTIEIEKLKD