HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P44921

Names and origin
Entry : P44921 (reviewed)
Entry name : YACG_HAEIN
Protein names : DNA gyrase inhibitor YacG
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : yacG
ORF names : HI_0891
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 2001-04-27
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA topoisomerase (ATP-hydrolyzing) inhibitor activity; negative regulation of DNA topoisomerase (ATP-hydrolyzing) activity; regulation of transcription, DNA-dependent; zinc ion binding
GO identifier : GO:0008657; GO:2000372; GO:0006355; GO:0008270
Keywords
Ligand & Biological process : Complete proteome; Metal-binding; Reference proteome; Zinc
General annotation
Sequence similarities : Belongs to DNA gyrase inhibitor YacG family
Reference
PubMed ID : 7542800;
Protein sequence
Length : 72 residues
>P44921|YACG_HAEIN Haemophilus influenzae Rd KW20
MIEVPCPICQKSVPWINESTFRPFCSKRCQLIDLGEWAAEEKAIPSDTADFAMDPNVSDE
WSIK