HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P44902

Names and origin
Entry : P44902 (reviewed)
Entry name : MOBB_HAEIN
Protein names : Molybdopterin-guanine dinucleotide biosynthesis adapter protein (MGD biosynthesis adapter protein) (Molybdenum cofactor biosynthesis adapter protein) (Moco biosynthesis adapter protein)
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : mobB
ORF names : HI_0851
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Evidence at protein level
Gene Ontology (GO)
GO term name : GTP binding; Mo-molybdopterin cofactor biosynthetic process
GO identifier : GO:0005525; GO:0006777
Keywords
Ligand & Biological process : Complete proteome; GTP-binding; Molybdenum cofactor biosynthesis; Nucleotide-binding; Reference proteome
General annotation
Sequence similarities : Belongs to MobB family
Reference
PubMed ID : 7542800; 10675023
Protein sequence
Length : 190 residues
>P44902|MOBB_HAEIN Haemophilus influenzae Rd KW20
MIFKVIFMNNQIPLLGITGYSGSGKTTLLEKLIPELIARHIRVSVIKHSHHNMQVDKEGK
DSWRMKEAGSSQVILANDERWAIMTETPKPVSLDYLAQQFDRTLTDLVLVEGFKQEPIPK
ILLHRQEMTKPLPEIDEYVLAVATNYPLEIDRTLLDINRIPQIADFIENWLHHFHGAR