HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P44889

Names and origin
Entry : P44889 (reviewed)
Entry name : TRPR_HAEIN
Protein names : Trp operon repressor homolog
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : trpR
ORF names : HI_0830
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; negative regulation of transcription, DNA-dependent; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription, DNA-dependent
GO identifier : GO:0005737; GO:0045892; GO:0043565; GO:0003700; GO:0006351
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; DNA-binding; Reference proteome; Repressor; Transcription; Transcription regulation
General annotation
Sequence similarities : Belongs to TrpR family
Subcellular location : Cytoplasm.
Reference
PubMed ID : 7542800
Protein sequence
Length : 109 residues
>P44889|TRPR_HAEIN Haemophilus influenzae Rd KW20
MYISRNLEQWNAFLQMLKIAFEENKAQEFLTLLLTADERDAVGLRLQIVSQLIDKNMPQR
EIQQNLNTSAATITRGSNMIKTMDPDFMQWMKQHLDLIEKN