HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P44879

Names and origin
Entry : P44879 (reviewed)
Entry name : CSRA_HAEIN
Protein names : Carbon storage regulator homolog
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : csrA
ORF names : HI_0813
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : RNA binding; mRNA catabolic process; regulation of carbohydrate metabolic process
GO identifier : GO:0003723; GO:0006402; GO:0006109
Keywords
Ligand & Biological process : Complete proteome; RNA-binding; Reference proteome
General annotation
Sequence similarities : Belongs to CsrA family
Reference
PubMed ID : 7542800
Protein sequence
Length : 71 residues
>P44879|CSRA_HAEIN Haemophilus influenzae Rd KW20
MLILTRKVGESVLIGDDISITVLSVRGNQVKLGVEAPKEVSVHREEIYQRIKQTKDEPYL
GSS