HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P44841

Names and origin
Entry : P44841 (reviewed)
Entry name : TUSA_HAEIN
Protein names : Sulfurtransferase TusA homolog (EC 2.8.1.-)
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : tusA
ORF names : HI_0721
EC number : 2.8.1.-
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; sulfurtransferase activity
GO identifier : GO:0005737; GO:0016783
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Reference proteome; Transferase
General annotation
Sequence similarities : Belongs to UPF0033 family, TusA subfamily
Subcellular location : Cytoplasm.
Reference
PubMed ID : 7542800
Protein sequence
Length : 87 residues
>P44841|TUSA_HAEIN Haemophilus influenzae Rd KW20
MSEISVTQTLDTLGLRCPEPVMLVRKNIRHLNDGEILLIIADDPATTRDIPSFCQFMDHT
LLQCEVEKPPFKYWVKRGK