HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P44812

Names and origin
Entry : P44812 (reviewed)
Entry name : ZAPB_HAEIN
Protein names : Cell division protein ZapB
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : zapB
ORF names : HI_0668
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Evidence at protein level
Gene Ontology (GO)
GO term name : barrier septum assembly; cytokinesis by binary fission; cytoplasm
GO identifier : GO:0000917; GO:0043093; GO:0005737
Keywords
Ligand & Biological process : Cell cycle; Cell division; Coiled coil; Complete proteome; Cytoplasm; Direct protein sequencing; Reference proteome; Septation
General annotation
Sequence similarities : Belongs to ZapB family
Subcellular location : Cytoplasm.
Reference
PubMed ID : 7542800; 9719565; 10675023
Protein sequence
Length : 80 residues
>P44812|ZAPB_HAEIN Haemophilus influenzae Rd KW20
MSLEILDQLEEKIKQAVETIQLLQLEVEELKEKNAESQRNIENLQTENEQLKNEHRNWQE
HIRSLLGKFDNV