HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P44778

Names and origin
Entry : P44778 (reviewed)
Entry name : FUCM_HAEIN
Protein names : L-fucose mutarotase (EC 5.1.3.n2) (Fucose 1-epimerase) (Type-2 mutarotase)
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : fucU
ORF names : HI_0612
EC number : 5.1.3.n2
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : L-fucose metabolic process; cytoplasm; fucose binding; racemase and epimerase activity, acting on carbohydrates and derivatives
GO identifier : GO:0042354; GO:0005737; GO:0042806; GO:0016857
Keywords
Ligand & Biological process : Carbohydrate metabolism; Complete proteome; Cytoplasm; Fucose metabolism; Isomerase; Reference proteome
General annotation
Pathway : Carbohydrate metabolism; L-fucose metabolism.
Sequence similarities : Belongs to RbsD / FucU family, FucU mutarotase subfamily
Subcellular location : Cytoplasm.
Reference
PubMed ID : 7542800
Protein sequence
Length : 156 residues
>P44778|FUCM_HAEIN Haemophilus influenzae Rd KW20
MLKGIHPALSPELLKTLAEMGHGDEIVLADAHFPAHSLHKNVIRADGISIDILLEAITPL
FEFDAYVDAPLLMMKAVEGDSLDPNVETRYLNAIESAVGFTPNLTCLERFDFYTRAKQAY
AVVVSGEIAKYGNIIIKKGVTPIL